DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss2.12

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:247 Identity:70/247 - (28%)
Similarity:112/247 - (45%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI-GDADSVTVYFGATWRTNA 100
            :.||..|..|..|..|:.|.|.:.....||||:||.:|::||.||: ||..|.::     |:.  
 Frog   258 ESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCVQGDTSSPSL-----WKA-- 315

  Fly   101 QFTHWVGN--------------GNFIKH-------SSADIALIRI-PHVDFWHMVNKVELPSYND 143
                ::|.              ...|.|       :|.||||::: ..:.|..:...|.||:|..
 Frog   316 ----FIGKIKMPSYYDSSAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVCLPNYGM 376

  Fly   144 RYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGSVGDNILCVRTP-DGK 204
            ::.:....:  ..|||.|.....:...|:...:.:|..:.|:.   |.|::..:::|...| .|.
 Frog   377 QWEEGQPCY--ISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAITSSMICAGYPKGGV 439

  Fly   205 STCGGDSGGPLVTHDGTK--LVGVTNFGSVAGCQS-GAPAGFQRVTYHLDWI 253
            .:|.|||||||||...:.  |||.|::|.  ||.: ..|..:..:|..|.||
 Frog   440 DSCQGDSGGPLVTKTNSLWWLVGDTSWGD--GCANVYRPGVYGNMTVFLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/243 (28%)
Tryp_SPc 40..256 CDD:238113 69/244 (28%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055
Tryp_SPc 261..489 CDD:238113 67/242 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.