DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC100495541

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:278 Identity:76/278 - (27%)
Similarity:120/278 - (43%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGG 67
            :.:.|..:|:|..|..:.....|.......:..:..||..|..|.:|..|:.|.|.:.|...|||
 Frog   325 SLLCIWLIAMAKDSSVSPSVSDTTSTLSCGSPLVSNRIVGGTDATDGAWPWQVSLDYHGSHICGG 389

  Fly    68 SIIAHDWVLTAEHCIGDADSVTVY---FGATWRTNAQFTHWVG--------NGNFIKHSSADIAL 121
            |:||..|::||.||...:.|.:.|   .|| ::.:....|.:.        |......::.||||
 Frog   390 SLIATQWIMTAAHCFEYSKSPSDYKIRLGA-YQLSLISPHEITSTVDSIIVNSPNSSSTNTDIAL 453

  Fly   122 IRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG--GTYDGSPLPDYLQCVDLQIIHNSE 183
            ||:.. :.:...:..:.|||.:|.:.:..|.|..  |||  .:....|.|..||.|...:|..:.
 Frog   454 IRLTSPITYTKYILPICLPSTSDGFTEGMECWVT--GWGTIASQVNLPYPMTLQQVMTPLISRAT 516

  Fly   184 CSGYYGSVGDNILCVRTP----------DGKSTCGGDSGGPLVTH-DGT-KLVGVTNFGSVAGCQ 236
            |:..|.:  |::|.|..|          ..|.:|.||||||||.. .|. ..:|:.::|.  ||.
 Frog   517 CNQMYNT--DSLLSVVVPLDQICAGYAAGQKDSCQGDSGGPLVCQLQGIWYQIGIVSWGE--GCA 577

  Fly   237 -SGAPAGFQRVTYHLDWI 253
             ...|..:..|..:..|:
 Frog   578 VRNRPGVYTLVPAYYSWV 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/240 (29%)
Tryp_SPc 40..256 CDD:238113 70/241 (29%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113
Tryp_SPc 362..595 CDD:238113 69/239 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.