DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:272 Identity:78/272 - (28%)
Similarity:118/272 - (43%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASASGATMPRLATEKLTPVHTKDMQ-----------GRITNGYPAEEGKAPYTVGLGFSGGWWCG 66
            |..:.:|:|...|:|  |..|...|           .:|..|..|..|:.|:...|......:||
 Frog   511 AKPASSTLPSKPTQK--PFSTIKPQECGSRPGLTKPNKIVGGLDAVRGEIPWQASLKEGSRHFCG 573

  Fly    67 GSIIAHDWVLTAEHCIGD--ADSVTVYFGATWRTNAQ-FTHWVGNGNFIKHS-------SADIAL 121
            .:||...|:::|.||...  .|.||.:.|:|..:.|. ....:.....|:|.       ..|:|:
 Frog   574 ATIIGDRWLVSAAHCFNQTKVDQVTAHMGSTALSGADTIAIKISLKRVIQHPHFNPLTLDFDVAV 638

  Fly   122 IRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS-PLPDYLQCVDLQIIHNSEC 184
            :.: ..:.|...|..|.|||...::.  ..|..:..|||...:|: ..|:.||...:.||....|
 Frog   639 LELASSLTFNKYVQPVCLPSALQKFP--AGWKCMISGWGNIKEGNVSKPEVLQKASVGIIDQKIC 701

  Fly   185 SGYYG-SVGDNILCVRTPDGK-STCGGDSGGPLVTHDGTK---LVGVTNFGSVAGC-QSGAPAGF 243
            |..|. |:.:.::|....||| .:|.|||||||...:...   |.|:.::|  .|| |:..|..:
 Frog   702 SVLYNFSITERMICAGFLDGKVDSCQGDSGGPLACEESPGIFFLAGIVSWG--IGCAQAKKPGVY 764

  Fly   244 QRVTYHLDWIRD 255
            .|||...|||.|
 Frog   765 SRVTKLKDWILD 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/231 (29%)
Tryp_SPc 40..256 CDD:238113 70/234 (30%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113 67/230 (29%)
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.