DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and klkb1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002934450.3 Gene:klkb1 / 100486524 XenbaseID:XB-GENE-985051 Length:629 Species:Xenopus tropicalis


Alignment Length:249 Identity:77/249 - (30%)
Similarity:110/249 - (44%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVG--LGFSGGW---WCGGSIIAHDWVLTAEHCIGD---ADSVTVYFGAT 95
            ||..|..:..|:.|:.|.  |..:..:   .||||||::.|::||.||...   .....:|.|..
 Frog   390 RIVGGTDSVLGEWPWQVSMHLRLTASYKKHACGGSIISNQWIVTAAHCFAMHPLPQMWIIYSGVV 454

  Fly    96 WRTN-AQFT------------HWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYN 146
            ..:| .|.|            |:.|.||     ..||||::: ..:.|......:.||.....:.
 Frog   455 KLSNITQSTPFSETEQIIIHPHYTGAGN-----GTDIALLKLKTPISFNDHQKAICLPPREPTFV 514

  Fly   147 DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDGK-STCG 208
            ..|..|..  |||.|.:...|.:.||..::..|...||.|.|..  :...|||.....|| .:|.
 Frog   515 LPNSCWIT--GWGFTEESGSLANILQKAEVPQISTEECQGNYEQTRIDKKILCAGYKRGKIDSCK 577

  Fly   209 GDSGGPL--VTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHTGI 259
            |||||||  |..:...|.|:|::|.  || :.|.|..:.||:...|||.:||.:
 Frog   578 GDSGGPLACVVDEIWYLTGITSWGE--GCARPGKPGVYTRVSEFTDWIIEHTRV 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/241 (30%)
Tryp_SPc 40..256 CDD:238113 74/243 (30%)
klkb1XP_002934450.3 APPLE 21..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 290..373 CDD:128519
Tryp_SPc 391..626 CDD:238113 74/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.