DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss11f

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:284 Identity:79/284 - (27%)
Similarity:129/284 - (45%) Gaps:40/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALAVASASGA-----TMPRLATEKLTP--------VHTKDMQGRITNGYPAEEGKAPYTVGLGF 59
            |.|:..|:|.|     ::|...|...|.        :....:..||..|..|..|..|:...|..
 Frog   152 LHLSEISSSDAQNLLYSVPSTTTAYTTTAADFTACGIGGPSVSNRIVGGTNAGLGSWPWQASLRL 216

  Fly    60 SGGWWCGGSIIAHDWVLTAEHCI---GDADS-------VTVYFGATWRTNAQFTHWVGNGNFIKH 114
            .|...||.|::...|::.|.||.   .||:|       :.||.|:.::......:    ..:..|
 Frog   217 LGSHTCGASLLNDTWLVAAAHCFDMNADANSWTVVLGTINVYSGSEFKIEKIIIY----EGYTSH 277

  Fly   115 SSA-DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQ 177
            :.. ||||::: ..::|..::..|.||..:|.:.|.:..:..  |||...||......||..:::
 Frog   278 NHRNDIALLKLFTPLNFTSIIRPVCLPEASDIFPDGSSCYIT--GWGALTDGGSASQVLQQAEVK 340

  Fly   178 IIHNSECSG---YYGSVGDNILCVRTPDGK-STCGGDSGGPLVTHDGTK--LVGVTNFGSVAGCQ 236
            ||::..||.   |.|.:..:::|.....|: .:|.|||||||||....:  |:|:.:||  .||.
 Frog   341 IINSDTCSSSQMYGGLIYPSMICAGYATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFG--YGCA 403

  Fly   237 -SGAPAGFQRVTYHLDWIRDHTGI 259
             ...|..:.|:||..:||..|:|:
 Frog   404 LPNKPGVYSRITYLRNWITAHSGL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/232 (29%)
Tryp_SPc 40..256 CDD:238113 68/234 (29%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 66/231 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.