DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC100331291

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:250 Identity:70/250 - (28%)
Similarity:109/250 - (43%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSG-GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR--- 97
            :.:|..|..|:.|..|:.|.|.... |..||.|::|..|:::|.||..|:|::......:||   
Zfish   688 RAKIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVASRWLVSAAHCFQDSDAIKYSDARSWRAYM 752

  Fly    98 --------TNAQFTHWVGNGNFIKH-------SSADIALIRI-PHVDFWHMVNKVELPSYNDRYN 146
                    :||..|..:  ...:.|       |..||||:.: ..|.|..:|..|.:|:.:..:.
Zfish   753 GMRVMNSVSNAAATRQI--RRIVLHSQYDQFTSDYDIALLELSAPVFFNELVQPVCVPAPSHVFT 815

  Fly   147 DYNEWWAVAC---GWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY-GSVGDNILCV-RTPDGKST 206
            .     ..:|   |||...:...|...||...:.||:::.|:..| .:|...:||. ....|...
Zfish   816 S-----GTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMYDDAVTPRMLCAGNIQGGVDA 875

  Fly   207 CGGDSGGPLVTHDGTK---LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHT 257
            |.||||||||..:..:   |.|:.::|.  || :...|..:.||....|||...|
Zfish   876 CQGDSGGPLVCLERGRRWFLAGIVSWGE--GCARQNRPGVYTRVIKFTDWIHQQT 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/242 (28%)
Tryp_SPc 40..256 CDD:238113 69/244 (28%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060
Tryp_SPc 691..927 CDD:238113 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.