DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Gm2663

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:275 Identity:76/275 - (27%)
Similarity:116/275 - (42%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGS 68
            |...|..|||               .|.::.|   :|..||...:...||.|.|.......||||
Mouse     6 FFTFLGAAVA---------------LPANSDD---KIVGGYTCPKHSVPYQVSLNDGISHQCGGS 52

  Fly    69 IIAHDWVLTAEHC--------IGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHS-------SAD 118
            :|...|||:|.||        :|: .::.|..|.....:|:        ..|:|.       ..|
Mouse    53 LINDQWVLSAAHCYKRRLQVRLGE-HNIDVLEGGEQFIDAE--------KIIRHPDYNKDTVDND 108

  Fly   119 IALIRIPHVDFWH-MVNKVELP----SYNDRYNDYNEWWAVACGWGGTYD-GSPLPDYLQCVDLQ 177
            |.||::......: .|:.|.||    |.|.:        .:..|||.|.. |...|..|||::..
Mouse   109 IMLIKLKSPAILNSQVSTVSLPRSCASTNAQ--------CLVSGWGNTVSIGGKYPALLQCLEAP 165

  Fly   178 IIHNSEC-SGYYGSVGDNILCVR-TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAP 240
            ::..|.| ..|.|.:..|:.|:. ...||.:|.||||||:|.:.  ::.|:.::|||...: |.|
Mouse   166 VLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNG--EIQGIVSWGSVCAMR-GKP 227

  Fly   241 AGFQRVTYHLDWIRD 255
            ..:.:|..:|.||::
Mouse   228 GVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/236 (28%)
Tryp_SPc 40..256 CDD:238113 69/239 (29%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 67/236 (28%)
Tryp_SPc 24..243 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.