DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and si:dkey-21e2.14

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003201094.1 Gene:si:dkey-21e2.14 / 100034620 ZFINID:ZDB-GENE-050208-699 Length:251 Species:Danio rerio


Alignment Length:228 Identity:67/228 - (29%)
Similarity:107/228 - (46%) Gaps:23/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA---------- 94
            |.:|..|:....||.|.:.:.....||||:|..::||||.||..::|.:||..||          
Zfish    26 IVDGREAKPHSRPYMVSVQYYEQHICGGSLITEEFVLTAAHCWKESDILTVVVGAHDLSKDKMYN 90

  Fly    95 TWRTNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGW 158
            ::...:...|...|.|.:.:   |:.|:::.. |.....|..:.||  .|..:...:......||
Zfish    91 SFEVASYLPHPDYNSNTLGN---DLMLLKLKEKVRLSDNVGLISLP--KDGEDVEADTHCSVAGW 150

  Fly   159 GGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDGKSTCGGDSGGPLVTHDGT 221
            |..:...|:.|.|...:..|::::||...:||  :...::||....|  :|.||||||||.  |.
Zfish   151 GTLWMNGPVSDRLMEAETVIMYDAECERRWGSDYMASKLICVYGYGG--SCIGDSGGPLVC--GV 211

  Fly   222 KLVGVTNFGSVAGCQSG-APAGFQRVTYHLDWI 253
            ..||||::.....|.|. .|..:.|::.:|.||
Zfish   212 TAVGVTSYSDHYLCNSRLLPNVYTRISAYLKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/226 (29%)
Tryp_SPc 40..256 CDD:238113 67/228 (29%)
si:dkey-21e2.14XP_003201094.1 Tryp_SPc 26..245 CDD:238113 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.