DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and si:dkey-78l4.10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017208791.2 Gene:si:dkey-78l4.10 / 100034472 ZFINID:ZDB-GENE-060503-175 Length:262 Species:Danio rerio


Alignment Length:232 Identity:70/232 - (30%)
Similarity:106/232 - (45%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTH 104
            |.||..|:....||.|.:...|...|||.:|..::||||.||....:::||..||.....:..:.
Zfish    26 IVNGSVAKPHSRPYMVSVQLDGQHICGGFLITEEFVLTAAHCWNGEENLTVVVGAHDLRQSMASD 90

  Fly   105 WVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELP--------------SYNDRYNDYNEWWAVA 155
            .:...::|:|.|.:...|       |:.:...:|.              |..:.:.|.|...:||
Zfish    91 RIEVESYIRHPSYNSKFI-------WNDIMVFKLKERVTQNSSVGWISISKKNEHVDANTLCSVA 148

  Fly   156 CGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG---SVGDNILCVRTPDGKSTCGGDSGGPLVT 217
             |||...:|: |.|.|...::.||.|:||...:|   || ..::|.|...|  :|..|||||||.
Zfish   149 -GWGLLTNGT-LSDCLMEANVYIISNTECKSKWGRHFSV-SQMMCTRGHGG--SCRYDSGGPLVC 208

  Fly   218 HDGTKLVGVTNFGSVAGCQSGA-PAGFQRVTYHLDWI 253
              |...||:|:||....|.|.. |..:..::.:..||
Zfish   209 --GDTAVGITSFGDPHLCNSPKHPNVYTNISAYRPWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/230 (30%)
Tryp_SPc 40..256 CDD:238113 70/232 (30%)
si:dkey-78l4.10XP_017208791.2 Tryp_SPc 26..243 CDD:214473 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.