DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC100004427

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:239 Identity:77/239 - (32%)
Similarity:116/239 - (48%) Gaps:21/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQGRITNGYPAEEGKAPYTVGLGF--SGGWWCGGSIIAHDWVLTAEHCIG--DADSVTV 90
            |::||     |..|..|.||..|:...:.|  :|.::|.||:|:..|||||..|..  :...|.:
Zfish    31 PLNTK-----IVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVI 90

  Fly    91 YFGATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAV 154
            |.|.. .||....:.:.........:.||||::: ..|.|...:..|.|.:....:.|..|.|..
Zfish    91 YLGRL-TTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESWVT 154

  Fly   155 ACGWGGTYDGSP-LPDYLQCVDLQIIHNSECSGYYGSVG-DNILCVR--TPDGKSTCGGDSGGPL 215
              |||.|...:. |.|.|:.|:..|::|.|||...|... ||::|..  ...||:.|..|.|.||
Zfish   155 --GWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNLDNVICAGFVNETGKAPCWEDFGSPL 217

  Fly   216 VTHDGTKLV--GVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHT 257
            ||..|::.:  ||..| :..| |:|.|..:.||:.:.:|||::|
Zfish   218 VTRQGSQWIQSGVVVF-TFCG-QNGFPTLYARVSEYEEWIRNYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/224 (31%)
Tryp_SPc 40..256 CDD:238113 73/226 (32%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 71/229 (31%)
Tryp_SPc 36..257 CDD:238113 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.