DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss3a

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:237 Identity:78/237 - (32%)
Similarity:107/237 - (45%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            ||..|..:.||:.|:.|.|.|.....||||||...|:|||.||:     ..:.:...|...|..|
Zfish   297 RIVGGNLSAEGQFPWQVSLHFQNEHLCGGSIITSRWILTAAHCV-----YGIAYPMYWMVYAGLT 356

  Fly   104 HWVGNG-------NFIKHS-------SADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWA 153
            ....|.       ..|.||       ..||||:::.. :.|..||..:.||::.:::.|....| 
Zfish   357 ELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLPNFGEQFEDGKMCW- 420

  Fly   154 VACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGSVGDNILCVRTPD-GKSTCGGDSGGP 214
             ..|||.|.||........|..:.:|.|..||.   |.|.:...::|....| |..:|.||||||
Zfish   421 -ISGWGATEDGGDASVSQHCASVPLISNKACSQPEVYQGYLTAGMICAGYLDGGTDSCQGDSGGP 484

  Fly   215 LVTHDGT--KLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            |...|.:  ||||.|::|.  || :...|..:.|:|..|.||
Zfish   485 LACEDSSIWKLVGATSWGQ--GCAEKNKPGVYTRITQSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/235 (32%)
Tryp_SPc 40..256 CDD:238113 77/236 (33%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845
Tryp_SPc 298..525 CDD:238113 77/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.