DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and ctrb.2

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:234 Identity:79/234 - (33%)
Similarity:109/234 - (46%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGW-WCGGSIISNEWVLTAEHCIGGDAVTVYFGATWR-TNAQF 98
            ||.||..|.....|:.|.|..|.|: :||||:|:..||:||.||....:..|..|...| :||:.
Zfish    33 RIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWWVVTAAHCNVRTSHRVILGEHDRSSNAES 97

  Fly    99 THWVGSGNFITHG-------SADIALIRI--PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGW 154
            ...:..|....|.       :.||.||::  |.....| |:.|.|...||.:....:  .|..||
Zfish    98 IQTMTVGKVFKHPNFNMFTINNDILLIKLATPAKINTH-VSPVCLAETNDNFPGGMK--CVTSGW 159

  Fly   155 GGTYDGSP-LPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTH-D 217
            |.|...:| .|..||...|.::.|.:|..::| ..:.|.::|.. ..|..:|.||||||||.. |
Zfish   160 GLTKHNAPDTPALLQQAALPLLTNEDCKRFWG-NKITDLMVCAG-ASGASSCMGDSGGPLVCQKD 222

  Fly   218 GS-KLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRDHT 255
            |. .|||:.:|.|.. |....|..:.|||....|: |.|
Zfish   223 GVWTLVGIVSWGSSV-CSPSSPGVYARVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 76/228 (33%)
Tryp_SPc 37..254 CDD:238113 76/230 (33%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 76/228 (33%)
Tryp_SPc 34..259 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.