Sequence 1: | NP_729372.1 | Gene: | Jon66Ci / 38952 | FlyBaseID: | FBgn0035886 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_652652.3 | Gene: | CG18754 / 59145 | FlyBaseID: | FBgn0042106 | Length: | 341 | Species: | Drosophila melanogaster |
Alignment Length: | 230 | Identity: | 54/230 - (23%) |
---|---|---|---|
Similarity: | 77/230 - (33%) | Gaps: | 75/230 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 WVLTAEHC-IGG-------------------DAVT---------VYFGATWRTNAQFTHWVGSGN 106
Fly 107 FITHGSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL------- 163
Fly 164 --PDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTN 226
Fly 227 WVSGAG--------C-QAGHPAGFQRVTYHLDWIR 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon66Ci | NP_729372.1 | Tryp_SPc | 36..251 | CDD:214473 | 52/227 (23%) |
Tryp_SPc | 37..254 | CDD:238113 | 54/230 (23%) | ||
CG18754 | NP_652652.3 | CLIP | 35..84 | CDD:288855 | |
Tryp_SPc | 108..338 | CDD:238113 | 54/230 (23%) | ||
Tryp_SPc | 108..335 | CDD:214473 | 52/227 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45435756 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |