DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG34409

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:104/277 - (37%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEGRITNGYPAEEGKAPYTVGLGFSG------GWWCGGSIISNEWVLTAEHCIGGDAVTVYFGAT 91
            :|.|:..|..|..|:.|:...:.:..      .:.|.||:||:..::||.||:          ..
  Fly   246 VESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCV----------VN 300

  Fly    92 WRTNAQFTH-WVGSGNFITHGSADIALIR-IPHVDFWHMVNKVELPSY-ND----RYNDYNEWW- 148
            ..::.:.:| .:||.:    |:...|:.: |.|.::       :.|.| ||    |.|..|..: 
  Fly   301 LVSDLELSHVRLGSQD----GATPFAIEQVIVHPNY-------DQPKYANDIALLRINSTNGTFT 354

  Fly   149 --------------------AVACGW--GGTYDGSPLPDY-----LQCVDLQIIHNSECASYYGT 186
                                .||.||  |.|.:.|.:...     ::.:.|.|::.:.||..|.:
  Fly   355 PICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYAS 419

  Fly   187 GT--------VGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQA-------- 235
            .:        :..|.:|.:.:.....|.||||||.:....|.:.|.:...:..|..|        
  Fly   420 LSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGV 484

  Fly   236 -GHPAGFQRVTYHLDWI 251
             ..|..:..|:...|||
  Fly   485 TTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 56/272 (21%)
Tryp_SPc 37..254 CDD:238113 57/273 (21%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 56/272 (21%)
Tryp_SPc 252..501 CDD:238113 55/269 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.