DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG34171

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:291 Identity:64/291 - (21%)
Similarity:104/291 - (35%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SVVHPKDLSKVAKIEGRITNGY--PAEEGKAPYTVGLGF-------SGGWWCGGSIISNEWVLTA 75
            ::|.||:::.: ||     |.|  |.....:.|.|.|..       ....:|.|.|::|..|||:
  Fly    12 ALVLPKNITTI-KI-----NHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTS 70

  Fly    76 EHCIGGD---------AVTVYFGATWRTNAQFTHWVGSGNFITH------GSADIALIRIPH--- 122
            .|||...         .|.....:.::|.......|...|.|.|      ...|||:|::..   
  Fly    71 AHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVK 135

  Fly   123 VDFWHMVNKV----ELPSYND-------------RYNDYNEWWAVACGWGGTYDGSPLPDYLQCV 170
            :|..|:...|    .|...||             |:..::.                    :..|
  Fly   136 LDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHS--------------------MLLV 180

  Fly   171 DLQIIHNSEC----ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGA 231
            ::::....||    .|........:::|||:..: |..|..|.||||.. || :|.|:.  :...
  Fly   181 NVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFC-DG-QLYGIA--LGSI 240

  Fly   232 GCQAGHPAGFQRVTYHLDWIR-------DHT 255
            .|.:..|..|..|:::..|:.       |||
  Fly   241 NCSSPDPVFFSDVSFYNSWVTKIISEAVDHT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 55/262 (21%)
Tryp_SPc 37..254 CDD:238113 56/271 (21%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 53/255 (21%)
Tryp_SPc 38..263 CDD:304450 53/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.