DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and ctrl

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:269 Identity:86/269 - (31%)
Similarity:123/269 - (45%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGW-WCGGSII 67
            ||.:|:......|.| ....|. :|.|.....||.||..|..|..|:.|.|..|.|: :||||:|
 Frog     3 FLWLLSCIALIGSTY-GCGSPA-ISPVLSGYARIVNGENAVPGSWPWQVSLQDSTGFHFCGGSVI 65

  Fly    68 SNEWVLTAEHCIGGDAVTVYFGATWRTNAQ-----------FTHWVGSGNFITHGSA-DIALIRI 120
            |:.||:||.||....|..|..|...|::..           |.|    .|:.:...| ||.|:::
 Frog    66 SDFWVVTAAHCGVTTAHRVILGEYDRSSPAEPIQTKTIAKVFRH----PNYNSFTIANDITLLKL 126

  Fly   121 PH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDYLQCVDLQIIHNSECASY 183
            .. ..|.::|..|.:.|.:|.:|....  .|..|||.....|.| |:.||.|.|.::.|:||..|
 Frog   127 SSPASFSNIVAPVCVASSSDAFNGGER--CVTTGWGYVDAASRLTPNKLQQVALPLLSNTECQRY 189

  Fly   184 YGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSK--LVGVTNWVSGAGCQAGHPAGFQRVTY 246
            :|: .:.:.::|.. ..|..:|.||||||||......  |.|:.:|.|.. |....|..:.||:.
 Frog   190 WGS-KILNTMVCAG-ASGASSCMGDSGGPLVCQRNGAWVLAGIVSWGSST-CSPSSPGVYARVST 251

  Fly   247 HLDWIRDHT 255
            ...|: |.|
 Frog   252 LRSWM-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 75/231 (32%)
Tryp_SPc 37..254 CDD:238113 75/233 (32%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.