DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and ctrb2

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:264 Identity:79/264 - (29%)
Similarity:120/264 - (45%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGW-WCGGSIIS 68
            |.:|:..|...|.|...|  ..:..:.....||.||..|..|..|:.|.|....|: :||||:::
 Frog     4 LFLLSCIVLIGSTYGCGV--PAIKPIISGYARIVNGENAVSGSWPWQVSLQDRTGFHFCGGSLVN 66

  Fly    69 NEWVLTAEHCIGGDAVTVYFGATWRTNAQ-----------FTHWVGSGNFITHGSA-DIALIRIP 121
            |.||:||.||....:..|..|...|:::.           |.|    .|:.|:... ||.|:::.
 Frog    67 NLWVVTAAHCGVTTSHRVILGEYDRSSSAEPIQTMSISRVFKH----PNYNTNTMINDITLLKLS 127

  Fly   122 H-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDYLQCVDLQIIHNSECASYY 184
            . ..|...|..|.:|:.::.:|....  .:..|||.....|.| |:.||.|.|.::.|:||..|:
 Frog   128 STASFNSRVAPVCIPTSSEVFNSPER--CITTGWGYVDAYSKLSPNKLQQVTLPLLSNTECQRYW 190

  Fly   185 GTGTVGDNIICVRVVDGKGTCGGDSGGPLV-THDGS-KLVGVTNWVSGAGCQAGHPAGFQRVTYH 247
            | ..:...:||.. ..|..:|.|||||||| ..:|: .|.|:.:|.|.. |....|..:.||:..
 Frog   191 G-NKIHSTMICAG-ASGASSCMGDSGGPLVCARNGAWVLAGIVSWGSST-CSPSSPGVYARVSTL 252

  Fly   248 LDWI 251
            ..|:
 Frog   253 RSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 72/231 (31%)
Tryp_SPc 37..254 CDD:238113 72/232 (31%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.