DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Jon99Fi

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:272 Identity:172/272 - (63%)
Similarity:204/272 - (75%) Gaps:18/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLTILALAVASASAY---ESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS--GGW 60
            ||: |..||||||:|:|.   |..:.|..:..| ||:|||||||||.|||.||.|||.||  |.|
  Fly     1 MKL-LVFLALAVAAATAIPTPEQKLVPTPVKDV-KIQGRITNGYPAYEGKVPYIVGLLFSGNGNW 63

  Fly    61 WCGGSIISNEWVLTAEHCI-GGDAVTVYFGATWRTNAQFTHWVGSGNFITH-----GSA--DIAL 117
            |||||||.|.|||||.||. |...||:.:||:.|...|:|||||||||:.|     |:.  ||:|
  Fly    64 WCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISL 128

  Fly   118 IRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECAS 182
            ||.|||||||:|||||||||||||.||..|||||.|||||||||||||:||.||:||:..|:|:.
  Fly   129 IRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSR 193

  Fly   183 YYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYH 247
               |.::.||:||:....||.|||||||||||||:|::|||||::||.||||:|.||.|.|||.:
  Fly   194 ---TWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGY 255

  Fly   248 LDWIRDHTGIAY 259
            ||||||:|||:|
  Fly   256 LDWIRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 147/224 (66%)
Tryp_SPc 37..254 CDD:238113 149/226 (66%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 147/224 (66%)
Tryp_SPc 38..262 CDD:238113 149/226 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470726
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.