DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG9737

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:106/266 - (39%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIEGRITNGYPAEEGKAPYTVGLGF-SGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTN 95
            ::..||..|..||..:.|:...|.: |..:.|.|::|.:..:|||.||:.|:.|....|......
  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRL 209

  Fly    96 AQFT-----HWVGSGNFITHGSA------------------------DIALIRIPH-VDFWHMVN 130
            .:|.     ..:...|:::...|                        |||:||:.| |.|.|.|.
  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274

  Fly   131 KVELPSYNDRYNDYNEWWAVACGWGGTYD---------GSPLPDYLQCVDLQIIHNSECASYY-G 185
            .:.||:.::.............|||.| |         .||:...|:   :..:.|..|.... |
  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKLR---IPYVSNENCTKILEG 335

  Fly   186 TGT-VGDNIICVRVVDGKGTCGGDSGGPLVTHD--GSKLV--GVTNWVSGAGCQAGHPAGFQRVT 245
            .|. :|...||......|.||.|||||||:..|  .|:.|  ||.::.......||.||.:..|.
  Fly   336 FGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVA 400

  Fly   246 YHLDWI 251
            .:.|||
  Fly   401 EYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 70/260 (27%)
Tryp_SPc 37..254 CDD:238113 71/261 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/260 (27%)
Tryp_SPc 150..409 CDD:238113 71/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.