DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Jon99Cii

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:168/269 - (62%)
Similarity:200/269 - (74%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS--GGWWCG 63
            ||:|: .||||||:|:|..:.......:.:..|:|||||||||.|||.||.|||.||  |.||||
  Fly     1 MKLFV-FLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCG 64

  Fly    64 GSIISNEWVLTAEHCI-GGDAVTVYFGATWRTNAQFTHWVGSGNFITH-----GSA--DIALIRI 120
            ||||.|.|||||.||. |...||:.:||:.||..|:|||||||:.|.|     |:.  ||:|||.
  Fly    65 GSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRT 129

  Fly   121 PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYG 185
            ||||||.:|||||||||||||.||..|||||.|||||||||||||:||.||:|||..|:|:.   
  Fly   130 PHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSR--- 191

  Fly   186 TGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDW 250
            |.::.||:||:....||.|||||||||||||||::|||||::.|.||||:|.||.|.|||.:|||
  Fly   192 TWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDW 256

  Fly   251 IRDHTGIAY 259
            |||:|||:|
  Fly   257 IRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 147/224 (66%)
Tryp_SPc 37..254 CDD:238113 149/226 (66%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 149/226 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470733
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.