DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG11841

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:272 Identity:65/272 - (23%)
Similarity:98/272 - (36%) Gaps:88/272 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAEEGKAPYTVGLGFSG-----GWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNA 96
            |.:|.|||..:.|:...||...     .|:|||::|||..||||.||.                 
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF----------------- 119

  Fly    97 QFTHWVGSGNFITHGSADIALIRIPHVDFWHMVNKVELPSYN-------------DRYND----- 143
                      |..||  ::.::|:..::|....:..|...:.             ..|||     
  Fly   120 ----------FSEHG--EVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQ 172

  Fly   144 ------YNEWWAVAC---------------GWGGTYDGSPLPDYLQCVDLQIIHNSECASYYG-- 185
                  :|.:...||               |||...........|..|.|| .:...|.|...  
  Fly   173 LDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQ-GYKDRCVSSVDAN 236

  Fly   186 ----TGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGS-----KLVGVTNWVSGAGCQAGH-PAG 240
                .|....:.:|:...|.|.||.||||||::.:...     .::|:|:  :|..|.... |:.
  Fly   237 DELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSA 299

  Fly   241 FQRVTYHLDWIR 252
            :.||.|.|:||:
  Fly   300 YTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 63/269 (23%)
Tryp_SPc 37..254 CDD:238113 65/272 (24%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 64/270 (24%)
Tryp_SPc 72..310 CDD:214473 63/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.