DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG4815

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:88/222 - (39%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIISNEWVLTAEHC-----------IGGDAVTVYFGATWRTNAQFTHWVGSGNFITHGSADI 115
            |..::::...:|||.||           |||            .:|:|| |.|: ||..:     
  Fly    61 CSATLLTPRHILTAAHCFENLNRSKFHVIGG------------KSAEFT-WHGN-NFNKN----- 106

  Fly   116 ALIRIP-HVDFWHM-------VNKVELPSYNDRYNDYNEWW---------AVACGW---GGTYDG 160
            .|||:. |..:..|       |.|.:.| ...:|..|.:..         .:|.||   ||.:|.
  Fly   107 KLIRVQIHPKYAKMKFIADVAVAKTKYP-LRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDE 170

  Fly   161 SPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVT 225
            |....: :.:.:.|:...:|...... .:..||||....:.|..|.|||||||:.  |.::.|:.
  Fly   171 SRKKTF-RSMKVGIVSKRDCEKQLDR-KMPPNIICAGAYNNKTLCFGDSGGPLLL--GRQVCGIN 231

  Fly   226 NWVSGAGCQAGHPAGFQRVTYHLDWIR 252
            .|....| ....|..:..|.|:..:|:
  Fly   232 TWTFKCG-NNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 55/219 (25%)
Tryp_SPc 37..254 CDD:238113 56/222 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 56/222 (25%)
Trypsin 49..256 CDD:278516 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.