DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and SPE

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:246 Identity:62/246 - (25%)
Similarity:96/246 - (39%) Gaps:71/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIISNEWVLTAEHCI--------GGDAVTVYFG---------ATWRTNAQ------------ 97
            |||:::::.:||||.||:        |....:|..|         .|.:.|.|            
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEV 230

  Fly    98 ---FTHWVGSGNFITHGSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTY 158
               ..|.:.:.|.:...: ||||:|:.. |.:...|..:.||:.....|::.::.....|||.|.
  Fly   231 EKGIIHEMYAPNSVDQRN-DIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTE 294

  Fly   159 DGSPLPDYLQCVDLQIIHN----SECASYYGTGTV--GDNIICVRVVDGKGTCGGDSGGPL---- 213
            :..|     ..:.|:|..|    :.|...|.:..|  .|:.:|.....|..||||||||||    
  Fly   295 NMQP-----SAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPI 354

  Fly   214 ------------VTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIR 252
                        ||..|:|..|:..|          |..:.|....:|||:
  Fly   355 STGGRDVFYIAGVTSYGTKPCGLKGW----------PGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 60/243 (25%)
Tryp_SPc 37..254 CDD:238113 62/246 (25%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 62/246 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.