DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG16710

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:108/273 - (39%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGF---SGGWW-------CGGSIISNEWVLTAEHCI---GGDAVTVY 87
            ||..|...:..:.|:...:.:   |...|       |.||:|:|.:||||.||:   |.|...|.
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    88 FGA-TWRTNAQ-FTHWVGSGNFI-THGSADIAL-IRIPHVDFWHMVNKVELPSYND--------- 139
            .|. ...:|.. .||..|..:.. .|...|:.| |:..|    :||.: |.| |||         
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRH----YMVFE-ERP-YNDIALLRLKFP 228

  Fly   140 -RYN----------DY--------NEWWAVACGWGGT----YDGSPLPDYLQCVDLQIIHNSECA 181
             ||.          ||        |....:| |||.:    |....|..|:...:.     .||:
  Fly   229 VRYTAQIKPICVQLDYIFSNPSFSNHKLQIA-GWGLSHKQGYSNVLLQAYVNGRNA-----DECS 287

  Fly   182 -SYYGTGTVGDNIICVRVVDGKGTCGGDSGGPL--VTHDGSK----LVGVTNWVSGAGCQAGH-P 238
             |....|...:..||...:.|..||.|||||||  :...|.:    |.|:|::   ...|.|: |
  Fly   288 LSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSY---GYSQCGYGP 349

  Fly   239 AGFQRVTYHLDWI 251
            |.:.:.:..::||
  Fly   350 AAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 73/271 (27%)
Tryp_SPc 37..254 CDD:238113 74/272 (27%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 73/271 (27%)
Tryp_SPc 106..362 CDD:238113 72/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.