DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG31199

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:138 Identity:32/138 - (23%)
Similarity:51/138 - (36%) Gaps:19/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLTILAL---AVASASAYESVVHPKDLSKVAKIEGRITNGYPAE-EGKAPYTVGLGFSG----- 58
            |.|.::.|   .|.||...:......|..::..::.  |...|.| :..|....|.||.|     
  Fly     7 VLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQS--TFAIPTEHQWVARIVYGKGFEGKIRDN 69

  Fly    59 GWWCGGSIISNEWVLTAEHCI-----GGDAVTVYFGATWRTNAQFTHWVGSGNFITHGSADIALI 118
            |  |.|.::|...||...||.     ..:|.:|:.|...::.........:..:....|.:|.|.
  Fly    70 G--CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLA 132

  Fly   119 RIP-HVDF 125
            .|. |.|:
  Fly   133 EIAIHPDY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 25/102 (25%)
Tryp_SPc 37..254 CDD:238113 25/101 (25%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.