DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG31219

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:286 Identity:67/286 - (23%)
Similarity:96/286 - (33%) Gaps:115/286 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NGYPAEEGKAPYTVGLGFSGGW----------------WCGGSIISNEWVLTAEHCIGGDAVTVY 87
            ||||                 |                :|.||:|:|.:|||:.||:.|....:.
  Fly    98 NGYP-----------------WMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLS 145

  Fly    88 FGATWRTNAQFTH--------------------WVGSGNFITHG----------SADIALIR--- 119
            ..:........|:                    .:.....|.||          ..||||:|   
  Fly   146 LKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKM 210

  Fly   120 ------------IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDL 172
                        ||...|: ..:|:|:                 .|||.|.:|    .:.|.   
  Fly   211 PVRYRTGIMPICIPKHGFF-AKSKLEI-----------------AGWGKTNEG----QFSQV--- 250

  Fly   173 QIIHN-------SECASYYGTGTVGDNI-ICVRVVDGKGTCGGDSGGPL-VTHDGSK--LVGVTN 226
             ::|.       :.||..:....:..:: ||....||..||.||||||| ||.|.|.  |.|:|.
  Fly   251 -LMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITT 314

  Fly   227 WVSGAGCQAGHPAGFQRVTYHLDWIR 252
            :.|....|.|.|..:.|.:..|.||:
  Fly   315 YGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 65/283 (23%)
Tryp_SPc 37..254 CDD:238113 67/286 (23%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 65/283 (23%)
Tryp_SPc 90..342 CDD:238113 67/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.