DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG17475

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:292 Identity:92/292 - (31%)
Similarity:117/292 - (40%) Gaps:78/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASAYE--SVVHPKDLSK-----VAKIEG-----RITNGYPAEEGKAPYTVGL-GFSG 58
            ||.:.:| .:.|:  |.|....||:     ::|.||     |:.||...:.|:|.|.:.| |..|
  Fly     9 ILVILLA-CTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYG 72

  Fly    59 GWWCGGSIISNEWVLTAEHCIGG------------------DAVTVYFGATWRTNAQFTHWVGSG 105
            |..|||.||....||||.||:.|                  ||  |||..        .||:...
  Fly    73 GHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDA--VYFVE--------EHWIHCN 127

  Fly   106 NFITHGSADIALIRIPHVDFWHMVNKVELPSYND--RYNDY------------NEWWAVACGWGG 156
            ........||||||:                 ||  ::|:|            |....:..|||.
  Fly   128 YNSPDYHNDIALIRL-----------------NDTIKFNEYTQPAELPTAPVANGTQLLLTGWGS 175

  Fly   157 TYDGSPLPDYLQCVDLQIIHNSECASYYGTG-TVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSK 220
            |......||.||...|..:..|.|....... :.|...||.....|:|.|.||||||| ||:| .
  Fly   176 TELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL-THNG-V 238

  Fly   221 LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIR 252
            |.|:.||  |..|..|.|.....|.|:|:|||
  Fly   239 LYGLVNW--GYPCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 78/248 (31%)
Tryp_SPc 37..254 CDD:238113 80/250 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 78/248 (31%)
Tryp_SPc 50..269 CDD:238113 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.