DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG31326

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:102/263 - (38%) Gaps:68/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAEEGKAPYTVGLGF----SGG--WWCGGSIISNEWVLTAEHC----------------I 79
            |..|...:.|:.|:.|.: |    |.|  :.|||::||...||:|.||                :
  Fly   274 IFQGKSLQRGQLPWLVAI-FERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSL 337

  Fly    80 GGDAVTVYFGATWR--------TNAQFTHWVGSGNFITHGSADIALIR----IPHVDF------W 126
            |.:.:.::....:|        .|.||..:.         .||:||:|    :.:.|:      |
  Fly   338 GRNTLAIHSDGEFRGVSQLIIHENFQFKQFT---------EADLALVRLDEPVRYTDYIVPICLW 393

  Fly   127 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGD 191
            ...|:::||.....|         ..|||....|:...:..:..||.|:..:.||.......|..
  Fly   394 STSNRMDLPQGLKSY---------VAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQP 449

  Fly   192 NIICVRVVDGKGTCGGDSGGPLVTHDGSKLV-------GVTNWVSGAGCQAGHPAGFQRVTYHLD 249
            :.:|.:.. |.|.|..|.||||:..:....|       ||.|..... |:...|:.|..|..|::
  Fly   450 SSLCAKKT-GAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENT-CELSKPSVFTDVAKHIE 512

  Fly   250 WIR 252
            |:|
  Fly   513 WVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 62/260 (24%)
Tryp_SPc 37..254 CDD:238113 64/263 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/260 (24%)
Tryp_SPc 277..514 CDD:214473 61/257 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.