DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG9649

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:112/287 - (39%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASASAYESVVHPKDLSKVAKIEGR--------ITNGYPAEEGKAPYTVGL----GFSGGWWCGGS 65
            ::..|..|..:|:.:.:::.|.||        |.||...|.|:.|:...|    |....:.|||:
  Fly   225 SNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGT 289

  Fly    66 IISNEWVLTAEHC----------------IGGDAVTVY-FGATWRTNAQFTHWVGSGNFITHGSA 113
            :||...|::|.||                :|.:::.:: .|||........|...:.|..|  .|
  Fly   290 LISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYT--DA 352

  Fly   114 DIALIRIP-HVD---------FWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 168
            |:||:::. |||         .|:....:||||.:..|         ..|||....|:......:
  Fly   353 DLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGEDEKGNRNTRLAK 408

  Fly   169 CVDLQIIHNSEC---ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSG 230
            ..|..||...||   .|......:..:.||.......|.|.|||||.|:..:..  :.:...|..
  Fly   409 MTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQD--IWMLRGVVS 471

  Fly   231 AG------CQAGHPAGFQRVTYHLDWI 251
            ||      |....|..:..|..|::|:
  Fly   472 AGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 65/262 (25%)
Tryp_SPc 37..254 CDD:238113 65/255 (25%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/253 (25%)
Tryp_SPc 259..497 CDD:214473 63/250 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.