DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG13318

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:238 Identity:59/238 - (24%)
Similarity:86/238 - (36%) Gaps:75/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHWVGSGNFITHGSADIALIRIPHVDFWH 127
            ||::|:.:.||||.|.:....:| ||      ..:...|..:.......:.|:.:..:       
  Fly   190 GGALITAQHVLTAAHKVYNLGLT-YF------KVRLGEWDAASTSEPIPAQDVYISNV------- 240

  Fly   128 MVNKVELPSY--NDRYNDY-----------------------------NEWWAVACGWG------ 155
            .||    ||:  |:..||.                             ...|  ..|||      
  Fly   241 YVN----PSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFVGQRCW--VAGWGKNDFGA 299

  Fly   156 -GTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGD-------NIICVRVVDGKGTCGGDSGGP 212
             |.|....     :.||:.:|.|:.|.:......:|.       :.||.....||..|.||.|.|
  Fly   300 TGAYQAIE-----RQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSP 359

  Fly   213 LV-THDGS-KLVGVTNWVSGAGC-QAGHPAGFQRVTYHLDWIR 252
            || |.:|. .:||:..|  |.|| |||.|..:..|..:|.||:
  Fly   360 LVCTSNGVWYVVGLVAW--GIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 57/235 (24%)
Tryp_SPc 37..254 CDD:238113 59/238 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 59/238 (25%)
Tryp_SPc 169..399 CDD:214473 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.