DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and MP1

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:268 Identity:69/268 - (25%)
Similarity:109/268 - (40%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFS-----GGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWR-T 94
            |:..|....:.:.|:...:.::     .|..||||:|::.:||||.||:..      ..:.|. |
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSA------IPSDWELT 195

  Fly    95 NAQFTHWVGSGN------------------------FITH----GSA-----DIALIRI-PHVDF 125
            ..:...|..|.|                        .|.|    |::     ||||:|: ..|.:
  Fly   196 GVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQY 260

  Fly   126 WHMVNKVELPSYNDRYND-YNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGT--G 187
            ...:..|.||:...::|: :.....|..|||.|.........|: .:|..:..|||...|.|  .
  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-AELDTVPTSECNQRYATQRR 324

  Fly   188 TVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSK------LVGVTNWVSGAGCQAGHPAGFQRVTY 246
            ||....:|...|:|..:|.|||||||:..|.|.      :.||.::........|.|..:.||..
  Fly   325 TVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEA 389

  Fly   247 HLDWIRDH 254
            :|:||.::
  Fly   390 YLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 67/263 (25%)
Tryp_SPc 37..254 CDD:238113 68/265 (26%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 67/263 (25%)
Tryp_SPc 138..397 CDD:238113 68/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.