DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG18223

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:235 Identity:53/235 - (22%)
Similarity:95/235 - (40%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 APYTVGLG-------FSGGWWCGGSIISNEWVLTAEHCI--------GGDAVTVYFGATWR---- 93
            |.|.|.:.       |....:|||.|||..::||:.||.        ....:.|..|.|.|    
  Fly    58 AKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122

  Fly    94 ----TNAQFTHWVGSGNFITHGSADIALI----RIPHVDFWHMVNKVELPSYNDRYN-DYNEWWA 149
                .|.:.........|....:.:|||:    ::|..:  .:|..:.||:.:.... :|     
  Fly   123 KGLSLNMEVKKIFVPDKFTVFNTNNIALMMLAKKLPLDN--PLVGVINLPTADPEPGLNY----- 180

  Fly   150 VACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDG---KGTCGGDSGG 211
            ...|||..:.|.||...:..:|::::....|..  ......:.::|...::.   :..|.||:|.
  Fly   181 TVLGWGRIFKGGPLASDILHIDVELLPRDICEK--KVHIFKEEMMCAGNLNNTMDENPCAGDTGS 243

  Fly   212 PLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251
            ||:.::  .:.||.::..|.|.:. .|:.:..|..|:|||
  Fly   244 PLIFNE--TVFGVVSYRVGCGSKT-LPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 51/233 (22%)
Tryp_SPc 37..254 CDD:238113 53/235 (23%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/233 (22%)
Tryp_SPc 60..280 CDD:214473 50/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.