DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and yip7

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:272 Identity:130/272 - (47%)
Similarity:165/272 - (60%) Gaps:17/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLT-ILALAVASASAYESV--VHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS---GG 59
            ||||:. :||||.|||....::  |||:|......|.||||||..|..|:.||.|||.||   |.
  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65

  Fly    60 WWCGGSIISNEWVLTAEHCIGGDA-VTVYFGATWRTNAQFTHWVGSGNFITHGS-------ADIA 116
            ||||||||.|||||||.||..|.| ||:|:|||.||:.:||..|.|..|..|.|       .||:
  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130

  Fly   117 LIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYD-GSPLPDYLQCVDLQIIHNSEC 180
            ||:...|.|...|||:.||:.::.|:.|....|||.|||.|.| .:.:...||.|||.||.||:|
  Fly   131 LIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKC 195

  Fly   181 ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVT 245
            ...:|:..|...::||...:...||.|||||||.. || .|:|.|::.|..||::|.||.|.|:|
  Fly   196 QETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL-DG-VLIGATSFGSADGCESGAPAAFTRIT 258

  Fly   246 YHLDWIRDHTGI 257
            |:.|||::.:||
  Fly   259 YYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 109/226 (48%)
Tryp_SPc 37..254 CDD:238113 110/228 (48%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 109/226 (48%)
Tryp_SPc 40..267 CDD:238113 110/228 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470863
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.