DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG10764

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:104/266 - (39%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISN 69
            |::|.|.|.....::.:..|..:|...||.|    |..|.|..:.:...:..|..:.|||:||..
  Fly    10 LSLLTLCVTENEHFKFLETPCGISTRPKISG----GDDAAEPNSIWMAAIFNSSDFQCGGTIIHM 70

  Fly    70 EWVLTAEHC-IGGDAVTVYFGATWRTNAQFTHWVGSGNFITHG------SADIALIRIPHVDFWH 127
            .:||:|.|| :.|..:.|..||.........|.| ...|:.|.      ..||.|:::..    .
  Fly    71 RFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV-INVFVHHDFIASEYRNDIGLLQLSE----S 130

  Fly   128 MVNKVEL--------PSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYY 184
            :|..|.:        |:..........:.|:  |||..  ...|...||.:.|..:..:||....
  Fly   131 IVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWGNR--NGKLSIMLQTIYLLHLKRNECKRKL 191

  Fly   185 GTGTVGDNIICVRVVDGKGTCGGDSGGPLVTH---DGSKLVGVTNWVSGAGCQAGHPAG-FQRVT 245
            .. .:....||....:| .||.|||||||.|:   ..:|...|...:...|.......| :..||
  Fly   192 NF-NLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVT 254

  Fly   246 YHLDWI 251
            .::|||
  Fly   255 SYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 58/233 (25%)
Tryp_SPc 37..254 CDD:238113 60/234 (26%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 61/237 (26%)
Tryp_SPc 38..263 CDD:238113 62/238 (26%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.