DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Ctrc

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:289 Identity:80/289 - (27%)
Similarity:119/289 - (41%) Gaps:68/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF-SGGWW---CGGS 65
            :|:||..:|.||...:...|.:||.      |:..|..|.....|:.|.|.: ....|   ||||
  Rat     4 ITVLAAILACASCCGNPAFPPNLST------RVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGS 62

  Fly    66 IISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHWVGSGNF-IT----HGSA------------ 113
            :|:...||||.|||               |..||:.||.|.: :|    .||.            
  Rat    63 LITTSHVLTAAHCI---------------NKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEK 112

  Fly   114 --------DIALIRIPH-VDFWHMVNKVELPSYNDRY-NDYNEWWAVACGWGGTYDGSPLPDYLQ 168
                    |||:|::.. |:..:.:....:|...... .||.   ....|||..:...|:.:.||
  Rat   113 WNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYP---CYVTGWGRLWTNGPIAEVLQ 174

  Fly   169 CVDLQIIHNSECASY-YGTGTVGDNIICVRVVDGKG---TCGGDSGGPL--VTHDGS-KLVGVTN 226
            .....|:.::.|:.. :....|...::|   ..|.|   .|.|||||||  ...||| ::.|:.:
  Rat   175 QGLQPIVSHATCSRLDWWFIKVRKTMVC---AGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVS 236

  Fly   227 WVSGAGCQAGH--PAGFQRVTYHLDWIRD 253
            :.|.:||.. |  |..|.||:.:.|||.:
  Rat   237 FGSSSGCNV-HKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 69/254 (27%)
Tryp_SPc 37..254 CDD:238113 70/257 (27%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 69/254 (27%)
Tryp_SPc 30..265 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.