DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG12133

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:279 Identity:69/279 - (24%)
Similarity:103/279 - (36%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAEEGKAPYTVGLGFSG-------GWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRT 94
            |..|..|:..:.|:||.||:..       ...|.||:|::.:||||.||:.   |..::.|..|.
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN---VNDFYVARVRL 123

  Fly    95 NAQFTH------WVGSGNFI---THGSADIALIRIPHVDFWHMVNKVELPSYND----------R 140
            ....|.      |:.:|..|   .|...|:.| |:||..::....:    .|||          :
  Fly   124 GEHDTENDPDYTWLPNGAKIWAPAHVDIDVDL-RVPHEQYYTRNGR----HYNDIALLRLKSRVK 183

  Fly   141 Y-----------------NDYNEWWAVACGWG-------------GTYDGSPLPDYLQCVDLQII 175
            |                 :.:..:.....|||             ||..|.. ||          
  Fly   184 YTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMS-PD---------- 237

  Fly   176 HNSECASYYGTGTVGDNI-ICVRVVDGKGTCGGDSGGPLVTHDGS------KLVGVTNWVSGAGC 233
               ||.:.|.|..|..:| ||....||..|..||||.||:...|.      .|.|:|::..|...
  Fly   238 ---ECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS 299

  Fly   234 QAGHPAGFQRVTYHLDWIR 252
            ....||.:.:.:.:.:||:
  Fly   300 YGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 67/276 (24%)
Tryp_SPc 37..254 CDD:238113 69/279 (25%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/279 (25%)
Tryp_SPc 62..317 CDD:214473 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.