Sequence 1: | NP_729372.1 | Gene: | Jon66Ci / 38952 | FlyBaseID: | FBgn0035886 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 223 | Identity: | 46/223 - (20%) |
---|---|---|---|
Similarity: | 78/223 - (34%) | Gaps: | 68/223 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 GSIISNEWVLTAEHCIG-----------GDAVTVYFGATWRTNAQFTH----------------- 100
Fly 101 --------------WVGSGNFITHGSADIALIRIPH-VDFWHMVNKVELPSY----NDRYNDYNE 146
Fly 147 WWAVACGWGGTYDGSPLPDYLQCVDLQIIHN--SECASYYGTGTVGDNIICVRVVDGKGTCGGDS 209
Fly 210 GGPLV----THDGSKLVGVTNWVSGAGC 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon66Ci | NP_729372.1 | Tryp_SPc | 36..251 | CDD:214473 | 46/223 (21%) |
Tryp_SPc | 37..254 | CDD:238113 | 46/223 (21%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 45/221 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |