DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG9377

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:258 Identity:53/258 - (20%)
Similarity:93/258 - (36%) Gaps:88/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GYPAEE---GKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGG---DAVTVYFGATWRTNAQF 98
            ||..:|   |:.|:.|.:..|..:.|.|::|:...|:|..||:..   :.|.:..| .|....:.
  Fly   101 GYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAG-EWDAAVEL 164

  Fly    99 ---THWVGS-------GNF----ITHGSADIALIRIPHVDFWHMVNKVE---LPSYNDRYNDYNE 146
               .|...|       .|:    :.|   :||::.:.....:.:...|:   ||.....|| |::
  Fly   165 EPQPHQQRSVVETLVHPNYTQMPLAH---NIAILLVDKEKPFQLAPNVQPICLPPPRIMYN-YSQ 225

  Fly   147 WWAVACGWGGTYDG--SPLPDYLQCVDLQIIHNSECASYYGTGTVG------DNIICVRVVDGKG 203
            .:  ..||..:..|  :.||   :...|.::...:|.:......:|      |:::|        
  Fly   226 CY--VSGWQRSDFGRAAILP---KRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLC-------- 277

  Fly   204 TCGGDSGG---------------PLVTH----------------DGSKLVGV-TN------WV 228
             .|||.|.               ||..|                ||.:|:|: ||      |:
  Fly   278 -AGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 53/258 (21%)
Tryp_SPc 37..254 CDD:238113 53/258 (21%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 51/254 (20%)
Tryp_SPc 105..339 CDD:214473 50/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.