DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG31269

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:103/246 - (41%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFT 99
            ||..|..||:|.|||.:.| |.||...|||:||:..:||||.||:              .|| |.
  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV--------------ENA-FI 86

  Fly   100 HWV----GSGNFITHGSA-------------------DIALIRIPHVDFW-HMVNKVELPSYNDR 140
            .|:    |:..:...|..                   ||||:.:.....| .....:.||....:
  Fly    87 PWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ 151

  Fly   141 YNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTG---TVGDNIICVRVVDGK 202
            ..|.    .:..|||.|......|..||.:.||.:.:.||.:.....   .||.  ||.....|:
  Fly   152 PGDE----VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH--ICTFSRLGE 210

  Fly   203 GTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRD 253
            |.|.||||||||::  ..|||:.||  |..|..|.|.....|.::.||||:
  Fly   211 GACHGDSGGPLVSN--GYLVGLVNW--GWPCATGVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 75/242 (31%)
Tryp_SPc 37..254 CDD:238113 77/245 (31%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/242 (31%)
Tryp_SPc 38..258 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.