DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and sphinx1

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:289 Identity:74/289 - (25%)
Similarity:132/289 - (45%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF-----SGGW 60
            ||:.:|:|.|::..:           :.:..|:..||..||.|:.....|.||:.:     |...
  Fly     1 MKLVVTLLVLSLTVS-----------VGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLN 54

  Fly    61 WCGGSIISNEWVLTAEHCI----------------GGDAVTVYFGATWRTNAQFTHWVGSGNFIT 109
            :..|:||||:|:||.:..:                |.|.:.:|                ..||..
  Fly    55 YGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIY----------------KENFRF 103

  Fly   110 HGSAD--IALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDL 172
            |...|  |||::.|:..|...:::|.:|:|:.|:..|.....:.||:|.....:.||::::|:::
  Fly   104 HYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEV 168

  Fly   173 QIIHNSECASY------YGTGTVGDNIICVRVVDGKGTCGGDSGGPLVT-HDGSKLVGVTNWVSG 230
            ::::|:|||.|      |...|.|:..        ||.|.||.||.:|| ......:|:. |:..
  Fly   169 EVMNNTECAKYYTPLKWYEMCTSGEGF--------KGVCEGDIGGAVVTMGPNPTFIGII-WLMP 224

  Fly   231 AGCQAGHPAGFQRVTYHLDWIRDHTGIAY 259
            ..|..|:|:...||:.|:.||:..:|:.:
  Fly   225 ENCSIGYPSVHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 65/244 (27%)
Tryp_SPc 37..254 CDD:238113 66/246 (27%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 65/244 (27%)
Tryp_SPc 26..248 CDD:304450 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.