DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Prss30

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:256 Identity:77/256 - (30%)
Similarity:109/256 - (42%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS-GGWWCGGSIISNEWVLTAEHCIGGDAVTV 86
            |.:|       .|:|..|..|.||:.|:.|.|..: .|..||||:|...|||||.||........
Mouse    67 HSRD-------AGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPS 124

  Fly    87 YF-----GATWRTNAQFTHWVGSGNFITH--------GSADIALIRIPHVDFWHMVNKVELPSYN 138
            ::     |.|.......:..|...|...|        .|.||||:::...........|.||:..
Mouse   125 FYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPVCLPAAQ 189

  Fly   139 DRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYY---GTGTVGDNII-----C 195
            .........|..  |||.|.: ..:...||.:.:.::.:.:|...|   |:...|:.||     |
Mouse   190 TPLTPGTVCWVT--GWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLC 251

  Fly   196 VRVVDG-KGTCGGDSGGPLVTHDGSK--LVGVTNWVSGAGCQAGH-PAGFQRVTYHLDWIR 252
            ...|:| |.:|.||||||||....|.  .||:|:|  |.||...: |..:.||..::|||:
Mouse   252 AGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSW--GIGCARPYRPGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 72/240 (30%)
Tryp_SPc 37..254 CDD:238113 74/242 (31%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.