DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Mcpt2

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:281 Identity:78/281 - (27%)
Similarity:111/281 - (39%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTV--------GLGFS 57
            |:..|.::||.:.|.:..|.::                .|..:.....||..        ||...
  Rat     1 MQALLFLMALLLPSGAGAEEII----------------GGVESIPHSRPYMAHLDIVTEKGLRVI 49

  Fly    58 GGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGA-----------TWRTNAQFTHWVGSGNFITHG 111
                |||.:||.::||||.||.|.: :||..||           ..:...|..|  .|.|.:.: 
  Rat    50 ----CGGFLISRQFVLTAAHCKGRE-ITVILGAHDVRKRESTQQKIKVEKQIIH--ESYNSVPN- 106

  Fly   112 SADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQII 175
            ..||.|::: ..|:....||.|.|||.:|..:.....|  |.|||.|....|....|:.|:|:|:
  Rat   107 LHDIMLLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCW--AAGWGKTGVRDPTSYTLREVELRIM 169

  Fly   176 HNSECASY----YGTGTVGDNIICVRVVDGKGTC-----GGDSGGPLVTHDGSKLVGVTNWVSGA 231
            ....|..|    |...      :||    |..|.     .|||||||:      ..||.:.:...
  Rat   170 DEKACVDYRYYEYKFQ------VCV----GSPTTLRAAFMGDSGGPLL------CAGVAHGIVSY 218

  Fly   232 G-CQAGHPAGFQRVTYHLDWI 251
            | ..|..||.|.||:.::.||
  Rat   219 GHPDAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 70/244 (29%)
Tryp_SPc 37..254 CDD:238113 72/245 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 70/260 (27%)
Tryp_SPc 21..242 CDD:238113 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.