DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Prss34

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:107/251 - (42%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAEEGKAPYTVGLGFSG---GWW---CGGSIISNEWVLTAEHCI-----GGDAVTVYFG- 89
            |..|.|....:.|:.|.|.|..   ..|   ||||:|..:|||||.||:     ......|..| 
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    90 -------ATWRTNAQFTHWVGSGNFITHGSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNE 146
                   ...:......|...|......|.|||||:::.. |.....|:.|.||:.:.|.:....
  Rat    98 LRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKT 162

  Fly   147 WWAVACGWGGTYDGSPLPD--YLQCVDLQIIHNSECASYYGTGT--------VGDNIICVRVVDG 201
            ||  ..|||......|||.  :|:.|.:.|:.||:|...|.|.:        :.|:::|.. ::|
  Rat   163 WW--VAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAG-MEG 224

  Fly   202 KGTCGGDSGGPLVTHDGSK--LVGVTNWVSGAGC-QAGHPAGFQRVTYHLDWIRDH 254
            :.:|..|||||||......  .|||.:|  |.|| ....|..:.||..:|.||..:
  Rat   225 RDSCQADSGGPLVCRWNCSWVQVGVVSW--GIGCGLPDFPGVYTRVMSYLSWIHGY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 74/246 (30%)
Tryp_SPc 37..254 CDD:238113 76/249 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 75/247 (30%)
Tryp_SPc 33..275 CDD:214473 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.