DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG18420

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:259 Identity:69/259 - (26%)
Similarity:100/259 - (38%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIEGRITNGYPAEEGKAPYTVGLGFSGGWW-CGGSIISNEWVLTAEHC-IGGDAVTVYFGATWR- 93
            |:..||.||..|....:|:...|..|...: |||::||...||||.|| |....:.|..|...| 
  Fly    38 KLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRK 102

  Fly    94 ---------TNAQFTHWVGSGNFITHGSADIALIRI-----------PHVDFW-----HMVNKVE 133
                     .|..|.|.....|  ||.: ||||:|:           |....|     |.::.::
  Fly   103 LKGYREEHQVNRTFQHRFYDPN--THAN-DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIK 164

  Fly   134 LPSYNDRYNDYNEWWAVACGWGGT---YDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIIC 195
            :              ....|||.|   :|.|.    |:.:|:....:..||    .|:|..|..|
  Fly   165 V--------------LTGTGWGRTESMHDSSE----LRTLDISRQPSKMCA----FGSVLSNQFC 207

  Fly   196 VRVVDG---KGTCGGDSGGPLVT----HDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIR 252
            .    |   ...|.||:|||:..    .:..:.|.|...::...||  .|:.|..|..|:::||
  Fly   208 A----GNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 66/252 (26%)
Tryp_SPc 37..254 CDD:238113 67/254 (26%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 66/252 (26%)
Tryp_SPc 43..267 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.