DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30323

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:196 Identity:38/196 - (19%)
Similarity:68/196 - (34%) Gaps:53/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHWV------GSGNFITH--------- 110
            :|.||::|..||:|:..|:.....:.....:.|.|.:...:.      .|...|.|         
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDES 117

  Fly   111 ---GSADIALIRIPH----VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 168
               |..::||:::..    ..|..|:.:.||.|         .|...:.|||..|..|.:.....
  Fly   118 AISGCTELALLKLDRGVTGQRFAMMLPEKELNS---------TWLCNSLGWGRIYYVSYVYISAM 173

  Fly   169 CVDLQIIHNSECASYYGTGTVGDNII--------------------CVRVVDGKGT-CGGDSGGP 212
            |....:::::. .:::..|.....:|                    |:....|:|. |..|.|.|
  Fly   174 CPAFSMVYDNP-VTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSP 237

  Fly   213 L 213
            |
  Fly   238 L 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 38/196 (19%)
Tryp_SPc 37..254 CDD:238113 38/196 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 38/196 (19%)
Tryp_SPc 45..272 CDD:214473 38/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.