DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30286

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:244 Identity:63/244 - (25%)
Similarity:101/244 - (41%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGDA-VTVYFG--------------- 89
            :.|...::|:...|..||...|||:::::.::|||.|||..|. :||..|               
  Fly    39 HQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDC 103

  Fly    90 ----ATWRTNAQFTHWVGSGNFITHGSADIALIRIP-------HVDFWHMVNKVELPSYNDRYND 143
                ..:..:..|.|   .|...|:...||.|:|:.       |:....::....|....:|.:.
  Fly   104 LPPSEDFEIDVAFRH---GGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHR 165

  Fly   144 YNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGD 208
                 .||.|||.: ........|:.:.:..::...|:..|......|. |||....|. :|.||
  Fly   166 -----LVATGWGRS-PSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQ-ICVSHESGV-SCSGD 222

  Fly   209 SGGPL---VTHDGSKL---VGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251
            ||||:   :..||..|   ||:.:: ..|.|.:  |:.|..|..|:|||
  Fly   223 SGGPMGQAIRLDGRVLFVQVGIVSY-GNAECLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 61/242 (25%)
Tryp_SPc 37..254 CDD:238113 63/244 (26%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 63/244 (26%)
Tryp_SPc 39..268 CDD:214473 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.