DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30091

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:104/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGD--------AVTVYFG--- 89
            :|..|..|.|.|.|:...:..:..:.||||:|:|::||||.||:..|        .:||..|   
  Fly    36 KIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYH 100

  Fly    90 --ATWRTNAQFTH--------WVGSGNFITHGSADIALIRI-------PHVDFWHMVNKVELPSY 137
              ||...|  ..|        ::.....|.:...||||:|:       |.:....::...:|...
  Fly   101 LLATGEHN--HPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQ 163

  Fly   138 NDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC--ASYYGTGTVGDNIICVRVVD 200
            .|...::     .|.|||.|.:|. :.:.||.|.:..|....|  |.:|   |....:.|.....
  Fly   164 TDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRKMCEAAFWY---TFDYPMFCAGTAV 219

  Fly   201 GKGTCGGDSGGPLVTH---DGSKLVGVTNWVSGAGCQAGHPAG-FQRVTYHLDWI 251
            |:.||..||||||..|   ||.|.......|| .|.:.....| :..|..|:|:|
  Fly   220 GRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS-TGTEDCRGFGMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 70/248 (28%)
Tryp_SPc 37..254 CDD:238113 70/248 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 70/248 (28%)
Tryp_SPc 37..276 CDD:238113 70/248 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.