DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30088

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:299 Identity:77/299 - (25%)
Similarity:120/299 - (40%) Gaps:80/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALAVASASAY----------ESV-----VHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS 57
            :::::||.|.|          |.|     :....:|..:.:..||..|..|....||:...|.:|
  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65

  Fly    58 GGWWCGGSIISNEWVLTAEHC--------IGGDAVT----VYFGATWRTNAQF-----THWVGSG 105
            ....|||:|||:.::|||.||        :|...:|    ...|:......:|     |.:....
  Fly    66 SEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD 130

  Fly   106 NFITHGSADIALIRIPHVDFWHMVNKVELPSYNDRYN----------------DYNEWWAVACGW 154
            .|:.:   ||||:::               |.|.|:|                :.:|:.|.  ||
  Fly   131 RFLAN---DIALLKL---------------SRNIRFNVHIQPICLILNPAAAPNVHEFQAF--GW 175

  Fly   155 GGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVT---H 216
            |.| :.:...:.||...|....|..|.|.... .:..|.:||. ..|..||.|||||||||   :
  Fly   176 GQT-ETNHSANVLQTTVLTRYDNRHCRSVLSM-PITINQLCVG-FQGSDTCSGDSGGPLVTKVNY 237

  Fly   217 DG---SKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIR 252
            ||   ...:|:.:: ....||:  |..:..|..::.|||
  Fly   238 DGVWRYLQLGIVSF-GDDKCQS--PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 67/253 (26%)
Tryp_SPc 37..254 CDD:238113 69/255 (27%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 67/253 (26%)
Tryp_SPc 45..273 CDD:238113 67/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.