DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30087

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:66/250 - (26%)
Similarity:104/250 - (41%) Gaps:52/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQ--- 97
            |:.||..|....||:.|.:..:....|||||:::.::|||.||:..:..........||:..   
  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQG 105

  Fly    98 ---------------FTH-WVGSGNFITHGSADIALIRI-------PHVD-FWHMVNKVELPSYN 138
                           .|| :..:.|.:.    ||||:::       .|:. ...::|....||. 
  Fly   106 SNCSPRSEEYGIMKAITHRFYNAANHVN----DIALLKLNRSINFNVHIQPICILLNPASAPSV- 165

  Fly   139 DRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKG 203
            ..|..:        |||.|.... .|..||..:|:....:.|:..:.....| |.||.. .:.:.
  Fly   166 ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNG-NQICAG-HEERD 219

  Fly   204 TCGGDSGGPLVTH---DGSK---LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIR 252
            ||.|||||||||.   ||.|   .:|:.:: ....||:  |..:..|..:::|||
  Fly   220 TCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 63/247 (26%)
Tryp_SPc 37..254 CDD:238113 64/248 (26%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 63/247 (26%)
Tryp_SPc 42..272 CDD:238113 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.