DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG30082

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:265 Identity:62/265 - (23%)
Similarity:89/265 - (33%) Gaps:81/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGG-DAVTVYFG---------- 89
            ||..|..|:.|..|:...|..:....|.|::|:..:||||.||:.. ..:||..|          
  Fly    39 RIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDC 103

  Fly    90 ---------ATWRTNAQFTHWVGSGNFITHGSADIALIRIPHVDFWHMVNKV------------E 133
                     ..:.....:.|....|.  .....||.|:::...    :|.|:            :
  Fly   104 TSEFCIPTYEEYSVENAYIHTFFGGR--QDSRNDIGLLKLNGT----VVYKLFIRPICLFRDPGQ 162

  Fly   134 LPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC------ASYYGTGTVG-- 190
            :| |:..|.        |.|| |..|.......||.|:|..:..|:|      :..||....|  
  Fly   163 VP-YSSTYE--------AAGW-GKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQW 217

  Fly   191 --DNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVG--VTNWVSGAGCQAGH-----PAGFQRVTY 246
              |            ||.|||||||    ..|:..  :|..|.......||     |..:..|..
  Fly   218 RAD------------TCSGDSGGPL----SRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPS 266

  Fly   247 HLDWI 251
            ..:||
  Fly   267 FTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 60/263 (23%)
Tryp_SPc 37..254 CDD:238113 61/264 (23%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 60/263 (23%)
Tryp_SPc 40..274 CDD:238113 61/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.